IP range details

74.220.48.0/20

AS7029  ·  Windstream Communications LLC

Need more data or want to access it via API or data downloads? Sign up to get free access

Sign up for free ›

Summary

Country United States
Domain onecommunications.net
ASN AS7029
Registry arin
Hosted IPs 4,096
ID WINDSTREAM

WHOIS Details

NetHandle:      NET-74-220-48-0-1
OrgID:          WINDS-6
Parent:         NET-74-0-0-0-0
NetName:        WINDSTREAM
NetRange:       74.220.48.0 - 74.220.63.255
NetType:        allocation
OriginAS:       7029
RegDate:        2008-07-23
Updated:        2012-03-02
Source:         ARIN


OrgID:          WINDS-6
OrgName:        Windstream Communications LLC
CanAllocate:    
Street:         4005 North Rodney Parham Rd
City:           Little Rock
State/Prov:     AR
Country:        US
PostalCode:     72212
Comment:        Geofeed https://geofeed.windstream.com/GEO_Data.csv
RegDate:        2006-08-10
Updated:        2024-11-25
OrgAdminHandle: WINDS-ARIN
OrgTechHandle:  WINDS-ARIN
OrgAbuseHandle: WINDS1-ARIN
OrgRoutingHandle:   GRADY2-ARIN
Source:         ARIN


POCHandle:      WINDS1-ARIN
IsRole:         Y
LastName:       Windstream Abuse
FirstName:      
Street:         4001 Rodney Parham Rd
City:           Little Rock
State/Prov:     AR
Country:        US
PostalCode:     72212
RegDate:        2006-10-11
Updated:        2019-04-11
OfficePhone:    +1-800-347-1991
Mailbox:        abuse@windstream.net
Source:         ARIN


POCHandle:      WINDS-ARIN
IsRole:         Y
LastName:       Windstream Communications Inc
FirstName:      
Street:         4005 North Rodney Parham Rd
City:           Little Rock
State/Prov:     AR
Country:        US
PostalCode:     72212
RegDate:        2006-08-09
Updated:        2024-08-02
OfficePhone:    +1-888-292-3827
Mailbox:        ipadmin@windstream.net
Source:         ARIN

Hosted domains

There are 17 domain names hosted across 7 IP addresses on this ASN. Checkout our API to access full domain hosting information.

IP Address Domain Domains on this IP
74.220.53.60 mixedhops.com 7
74.220.53.80 doubledie.com 3
74.220.53.151 onecallschedule.com 2
74.220.53.70 philadelphiacriminaldefenselawyerblog.com 2
74.220.53.157 realwebaudio.com 1
74.220.53.150 sergeantschedule.com 1
74.220.53.178 blockjock.com 1

Hosted domains API

Our Hosted Domains API, or Reverse IP API returns a full list of domains that are hosted on a single IP address.
Useful for Cybersecurity

What are IP address ranges?

IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.

Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.

An API built with users in mind: reliable, accurate, and easy-to-use

Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.

IPinfo for all your IP geolocation needs

Our IP tools

Explore all tools
What is my IP

What is my IP

Test our data accuracy by viewing insights from your IP address.

See your IP address
Map IPs

Map IPs

Paste up to 500,000 IPs to see where they're located on a map.

Try Map IPs
Summarize IPs

Summarize IPs

Use our data visualization tool to create a visual overview of multiple IPs.

Try Summarize IPs