74.220.48.0/20
AS7029 · Windstream Communications LLC
Need more data or want to access it via API or data downloads? Sign up to get free access
Sign up for free ›Summary
Country |
United States
|
Domain | onecommunications.net |
ASN | AS7029 |
Registry | arin |
Hosted IPs | 4,096 |
ID | WINDSTREAM |
WHOIS Details
NetHandle: NET-74-220-48-0-1 OrgID: WINDS-6 Parent: NET-74-0-0-0-0 NetName: WINDSTREAM NetRange: 74.220.48.0 - 74.220.63.255 NetType: allocation OriginAS: 7029 RegDate: 2008-07-23 Updated: 2012-03-02 Source: ARIN OrgID: WINDS-6 OrgName: Windstream Communications LLC CanAllocate: Street: 4005 North Rodney Parham Rd City: Little Rock State/Prov: AR Country: US PostalCode: 72212 Comment: Geofeed https://geofeed.windstream.com/GEO_Data.csv RegDate: 2006-08-10 Updated: 2024-11-25 OrgAdminHandle: WINDS-ARIN OrgTechHandle: WINDS-ARIN OrgAbuseHandle: WINDS1-ARIN OrgRoutingHandle: GRADY2-ARIN Source: ARIN POCHandle: WINDS1-ARIN IsRole: Y LastName: Windstream Abuse FirstName: Street: 4001 Rodney Parham Rd City: Little Rock State/Prov: AR Country: US PostalCode: 72212 RegDate: 2006-10-11 Updated: 2019-04-11 OfficePhone: +1-800-347-1991 Mailbox: abuse@windstream.net Source: ARIN POCHandle: WINDS-ARIN IsRole: Y LastName: Windstream Communications Inc FirstName: Street: 4005 North Rodney Parham Rd City: Little Rock State/Prov: AR Country: US PostalCode: 72212 RegDate: 2006-08-09 Updated: 2024-08-02 OfficePhone: +1-888-292-3827 Mailbox: ipadmin@windstream.net Source: ARIN
Hosted domains
There are 17 domain names hosted across 7 IP addresses on this ASN. Checkout our API to access full domain hosting information.
IP Address | Domain | Domains on this IP |
---|---|---|
74.220.53.60 | mixedhops.com | 7 |
74.220.53.80 | doubledie.com | 3 |
74.220.53.151 | onecallschedule.com | 2 |
74.220.53.70 | philadelphiacriminaldefenselawyerblog.com | 2 |
74.220.53.157 | realwebaudio.com | 1 |
74.220.53.150 | sergeantschedule.com | 1 |
74.220.53.178 | blockjock.com | 1 |
Hosted domains API
What are IP address ranges?
IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.
Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.
An API built with users in mind: reliable, accurate, and easy-to-use
Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.
Our IP tools
Explore all toolsSummarize IPs
Use our data visualization tool to create a visual overview of multiple IPs.
Try Summarize IPs