43.229.60.0/22
AS133159 · Mammoth Media Pty Ltd
Need more data or want to access it via API or data downloads? Sign up to get free access
Sign up for free ›Summary
Country | Australia |
Domain | binarylane.com.au |
ASN | AS133159 |
Registry | apnic |
Hosted IPs | 1,024 |
ID | BINARYLANE-AU |
WHOIS Details
inetnum: 43.229.60.0 - 43.229.63.255 netname: BINARYLANE-AU descr: BINARY LANE PTY LTD descr: Level 1 / 303 Coronation Drive country: AU geoloc: -33.7852584 151.1293015 org: ORG-BLPL1-AP admin-c: BLA2-AP tech-c: BLA2-AP abuse-c: AB1360-AP status: ALLOCATED PORTABLE remarks: -------------------------------------------------------- remarks: To report network abuse, please contact mnt-irt remarks: For troubleshooting, please contact tech-c and admin-c remarks: Report invalid contact via www.apnic.net/invalidcontact remarks: -------------------------------------------------------- mnt-by: APNIC-HM mnt-lower: MAINT-BINARYLANE-AU mnt-routes: MAINT-BINARYLANE-AU mnt-irt: IRT-BINARYLANE-AU last-modified: 2021-01-11T05:11:51Z source: APNIC irt: IRT-BINARYLANE-AU address: S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068 e-mail: abuse@binarylane.com.au abuse-mailbox: abuse@binarylane.com.au admin-c: BLA2-AP tech-c: BLA2-AP auth: # Filtered remarks: abuse@binarylane.com.au was validated on 2024-08-28 mnt-by: MAINT-BINARYLANE-AU last-modified: 2024-08-28T13:16:37Z source: APNIC organisation: ORG-BLPL1-AP org-name: BINARY LANE PTY LTD org-type: LIR country: AU address: BTP HUB, Level 1 Suite 3 address: 10 Station Avenue phone: +61737215000 fax-no: +61737215001 e-mail: support@binarylane.com.au mnt-ref: APNIC-HM mnt-by: APNIC-HM last-modified: 2023-09-05T02:16:22Z source: APNIC role: ABUSE BINARYLANEAU country: ZZ address: S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068 phone: +000000000 e-mail: abuse@binarylane.com.au admin-c: BLA2-AP tech-c: BLA2-AP nic-hdl: AB1360-AP remarks: Generated from irt object IRT-BINARYLANE-AU remarks: abuse@binarylane.com.au was validated on 2024-08-28 abuse-mailbox: abuse@binarylane.com.au mnt-by: APNIC-ABUSE last-modified: 2024-08-28T13:16:45Z source: APNIC role: Binary Lane administrator address: S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068 country: AU phone: +617-3721-5021 fax-no: +617-3721-5021 e-mail: abuse@binarylane.com.au admin-c: BLA2-AP tech-c: BLA2-AP nic-hdl: BLA2-AP mnt-by: MAINT-BINARYLANE-AU last-modified: 2014-04-29T04:46:55Z source: APNIC route: 43.229.60.0/22 origin: AS133159 descr: BINARY LANE PTY LTD BTP HUB, Level 1 Suite 3 10 Station Avenue mnt-by: MAINT-BINARYLANE-AU last-modified: 2020-04-23T04:50:00Z source: APNIC
Hosted domains
There are 3,626 domain names hosted across 371 IP addresses on this ASN. Checkout our API to access full domain hosting information.
IP Address | Domain | Domains on this IP |
---|---|---|
43.229.63.33 | artisanarcade.com | 841 |
43.229.63.250 | antisense.com.au | 343 |
43.229.60.96 | brisbanebusinesshub.com | 172 |
43.229.62.201 | mjsmith.id.au | 150 |
43.229.61.122 | cranfield.co.nz | 136 |
43.229.62.195 | peonymelbourne.com.au | 95 |
43.229.61.61 | anglicanfocus.org.au | 93 |
43.229.62.248 | camdenvalleyfinancialplanning.com.au | 74 |
43.229.63.233 | bespokecatering.sydney | 73 |
43.229.63.60 | santofamilylawyers.com.au | 69 |
43.229.62.32 | vitalsoils.com.au | 54 |
43.229.61.62 | academyfunerals.co.nz | 50 |
43.229.62.80 | karenmazzella.com | 44 |
43.229.60.21 | firstinservice.com.au | 43 |
43.229.63.160 | rjlicorice.com | 37 |
43.229.60.90 | photoplay.tv | 35 |
43.229.63.112 | myecampus.com.au | 32 |
43.229.60.61 | sportsmediagroup.com.au | 31 |
43.229.63.3 | solartintpenrith.com.au | 30 |
43.229.61.178 | michaelchamberlain.au | 29 |
Hosted domains API
IP addresses in this range
What are IP address ranges?
IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.
Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.
An API built with users in mind: reliable, accurate, and easy-to-use
Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.
Our IP tools
Explore all toolsSummarize IPs
Use our data visualization tool to create a visual overview of multiple IPs.
Try Summarize IPs