IP range details

43.229.60.0/22

AS133159  ·  Mammoth Media Pty Ltd

Need more data or want to access it via API or data downloads? Sign up to get free access

Sign up for free ›

Summary

Country Australia
Domain binarylane.com.au
ASN AS133159
Registry apnic
Hosted IPs 1,024
ID BINARYLANE-AU

WHOIS Details

inetnum:        43.229.60.0 - 43.229.63.255
netname:        BINARYLANE-AU
descr:          BINARY LANE PTY LTD
descr:          Level 1 / 303 Coronation Drive
country:        AU
geoloc:         -33.7852584 151.1293015
org:            ORG-BLPL1-AP
admin-c:        BLA2-AP
tech-c:         BLA2-AP
abuse-c:        AB1360-AP
status:         ALLOCATED PORTABLE
remarks:        --------------------------------------------------------
remarks:        To report network abuse, please contact mnt-irt
remarks:        For troubleshooting, please contact tech-c and admin-c
remarks:        Report invalid contact via www.apnic.net/invalidcontact
remarks:        --------------------------------------------------------
mnt-by:         APNIC-HM
mnt-lower:      MAINT-BINARYLANE-AU
mnt-routes:     MAINT-BINARYLANE-AU
mnt-irt:        IRT-BINARYLANE-AU
last-modified:  2021-01-11T05:11:51Z
source:         APNIC

irt:            IRT-BINARYLANE-AU
address:        S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068
e-mail:         abuse@binarylane.com.au
abuse-mailbox:  abuse@binarylane.com.au
admin-c:        BLA2-AP
tech-c:         BLA2-AP
auth:           # Filtered
remarks:        abuse@binarylane.com.au was validated on 2024-08-28
mnt-by:         MAINT-BINARYLANE-AU
last-modified:  2024-08-28T13:16:37Z
source:         APNIC

organisation:   ORG-BLPL1-AP
org-name:       BINARY LANE PTY LTD
org-type:       LIR
country:        AU
address:        BTP HUB, Level 1 Suite 3
address:        10 Station Avenue
phone:          +61737215000
fax-no:         +61737215001
e-mail:         support@binarylane.com.au
mnt-ref:        APNIC-HM
mnt-by:         APNIC-HM
last-modified:  2023-09-05T02:16:22Z
source:         APNIC

role:           ABUSE BINARYLANEAU
country:        ZZ
address:        S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068
phone:          +000000000
e-mail:         abuse@binarylane.com.au
admin-c:        BLA2-AP
tech-c:         BLA2-AP
nic-hdl:        AB1360-AP
remarks:        Generated from irt object IRT-BINARYLANE-AU
remarks:        abuse@binarylane.com.au was validated on 2024-08-28
abuse-mailbox:  abuse@binarylane.com.au
mnt-by:         APNIC-ABUSE
last-modified:  2024-08-28T13:16:45Z
source:         APNIC

role:           Binary Lane administrator
address:        S04 Level 1 / 34 Coonan St, Indooroopilly Qld 4068
country:        AU
phone:          +617-3721-5021
fax-no:         +617-3721-5021
e-mail:         abuse@binarylane.com.au
admin-c:        BLA2-AP
tech-c:         BLA2-AP
nic-hdl:        BLA2-AP
mnt-by:         MAINT-BINARYLANE-AU
last-modified:  2014-04-29T04:46:55Z
source:         APNIC

route:          43.229.60.0/22
origin:         AS133159
descr:          BINARY LANE PTY LTD BTP HUB, Level 1 Suite 3 10 Station Avenue
mnt-by:         MAINT-BINARYLANE-AU
last-modified:  2020-04-23T04:50:00Z
source:         APNIC

Hosted domains

There are 3,626 domain names hosted across 371 IP addresses on this ASN. Checkout our API to access full domain hosting information.

IP Address Domain Domains on this IP
43.229.63.33 artisanarcade.com 841
43.229.63.250 antisense.com.au 343
43.229.60.96 brisbanebusinesshub.com 172
43.229.62.201 mjsmith.id.au 150
43.229.61.122 cranfield.co.nz 136
43.229.62.195 peonymelbourne.com.au 95
43.229.61.61 anglicanfocus.org.au 93
43.229.62.248 camdenvalleyfinancialplanning.com.au 74
43.229.63.233 bespokecatering.sydney 73
43.229.63.60 santofamilylawyers.com.au 69
43.229.62.32 vitalsoils.com.au 54
43.229.61.62 academyfunerals.co.nz 50
43.229.62.80 karenmazzella.com 44
43.229.60.21 firstinservice.com.au 43
43.229.63.160 rjlicorice.com 37
43.229.60.90 photoplay.tv 35
43.229.63.112 myecampus.com.au 32
43.229.60.61 sportsmediagroup.com.au 31
43.229.63.3 solartintpenrith.com.au 30
43.229.61.178 michaelchamberlain.au 29

Hosted domains API

Our Hosted Domains API, or Reverse IP API returns a full list of domains that are hosted on a single IP address.
Useful for Cybersecurity

IP addresses in this range

What are IP address ranges?

IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.

Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.

An API built with users in mind: reliable, accurate, and easy-to-use

Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.

IPinfo for all your IP geolocation needs

Our IP tools

Explore all tools
What is my IP

What is my IP

Test our data accuracy by viewing insights from your IP address.

See your IP address
Map IPs

Map IPs

Paste up to 500,000 IPs to see where they're located on a map.

Try Map IPs
Summarize IPs

Summarize IPs

Use our data visualization tool to create a visual overview of multiple IPs.

Try Summarize IPs