207.45.172.128/25
AS17378 · TierPoint, LLC
Need more data or want to access it via API or data downloads? Sign up to get free access
Sign up for free ›Summary
Country | United States |
Domain | tierpoint.com |
ASN | AS17378 |
Registry | arin |
Hosted IPs | 128 |
ID | TP4-HWT-207-45-160-0-20 |
WHOIS Details
NetHandle: NET-207-45-160-0-1 OrgID: TL-801 Parent: NET-207-0-0-0-0 NetName: TP4-HWT-207-45-160-0-20 NetRange: 207.45.160.0 - 207.45.175.255 NetType: allocation RegDate: 2004-04-26 Updated: 2021-07-01 Source: ARIN OrgID: TL-801 OrgName: TierPoint, LLC CanAllocate: Street: 12444 Powerscourt Drive Suite 450 City: St. Louis State/Prov: MO Country: US PostalCode: 63131 RegDate: 2017-01-18 Updated: 2024-03-19 ReferralServer: rwhois://rwhois.tierpoint.net:4321 OrgAdminHandle: CZUMB2-ARIN OrgTechHandle: CHEEK1-ARIN OrgTechHandle: CZUMB2-ARIN OrgTechHandle: JEREM7-ARIN OrgAbuseHandle: TIERP2-ARIN OrgNOCHandle: TIERP3-ARIN OrgDNSHandle: CZUMB2-ARIN Source: ARIN POCHandle: TIERP2-ARIN IsRole: Y LastName: Tierpoint Abuse FirstName: Street: 12444 Powerscourt Dr. Street: Suite 450 City: St. Louis State/Prov: MO Country: US PostalCode: 63131 RegDate: 2017-12-20 Updated: 2023-12-21 OfficePhone: +1-844-200-8718 Mailbox: abuse@tierpoint.com Source: ARIN POCHandle: CZUMB2-ARIN IsRole: N LastName: Czumbil FirstName: Romeo Street: 9999 Hamilton Blvd Street: Building #4 City: Breinigsville State/Prov: PA Country: US PostalCode: 18031 RegDate: 2016-06-14 Updated: 2023-06-16 OfficePhone: +1-610-994-3046 Mailbox: romeo.czumbil@tierpoint.com Source: ARIN POCHandle: JEREM7-ARIN IsRole: N LastName: Bussard FirstName: Jeremy Street: 1401 Russell St City: Baltimore State/Prov: MD Country: US PostalCode: 21230 RegDate: 2010-07-13 Updated: 2023-11-07 OfficePhone: +1-410-369-3900 Mailbox: jeremy.bussard@tierpoint.com Source: ARIN POCHandle: TIERP3-ARIN IsRole: Y LastName: Tierpoint NOC FirstName: Street: 12444 Powerscourt Dr. Street: Suite 450 City: St. Louis State/Prov: MO Country: US PostalCode: 63131 RegDate: 2017-12-20 Updated: 2023-12-21 OfficePhone: +1-844-200-8718 Mailbox: support@tierpoint.com Source: ARIN POCHandle: CHEEK1-ARIN IsRole: N LastName: Cheek FirstName: Brian Street: 3864 Courtney St Suite 130 City: Bethlehem State/Prov: PA Country: US PostalCode: 18017 RegDate: 2015-05-19 Updated: 2023-12-21 OfficePhone: +1-484-456-2158 Mailbox: brian.cheek@tierpoint.com Source: ARIN
Hosted domains
There are 55 domain names hosted across 33 IP addresses on this ASN. Checkout our API to access full domain hosting information.
IP Address | Domain | Domains on this IP |
---|---|---|
207.45.161.20 | ixs1.net | 6 |
207.45.167.242 | intlcompexchange.com | 5 |
207.45.160.181 | kosmitech.com | 4 |
207.45.163.8 | kassenterprises.com | 3 |
207.45.160.153 | backupnation.com | 2 |
207.45.160.160 | interregent.com | 2 |
207.45.163.5 | aplrepdirect.com | 2 |
207.45.165.49 | commandfinancial.com | 2 |
207.45.175.9 | hilinedm.com | 2 |
207.45.160.74 | eastlongmeadowhcc.com | 2 |
207.45.171.29 | thelindquistgroup.com | 2 |
207.45.160.151 | cetinguzel.com | 2 |
207.45.163.116 | registerbiogenwebcasts.com | 1 |
207.45.169.216 | importer-connection.com | 1 |
207.45.165.239 | nectarvoip.com | 1 |
207.45.163.83 | milwcntyretirementselfservice.com | 1 |
207.45.160.182 | tca-careers.com | 1 |
207.45.163.96 | crownfranchiseordering.com | 1 |
207.45.163.121 | msrelapsehcp.com | 1 |
207.45.164.13 | adeptra.co.uk | 1 |
Hosted domains API
IP addresses in this range
What are IP address ranges?
IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.
Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.
An API built with users in mind: reliable, accurate, and easy-to-use
Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.
Our IP tools
Explore all toolsSummarize IPs
Use our data visualization tool to create a visual overview of multiple IPs.
Try Summarize IPs