AS number details

AS62904

Eonix Corporation  ·  serverhub.com

AS62904 – Eonix Corporation

Country United States
Website serverhub.com
Hosted domains 471,328
Number of IPs 553,984
ASN type Hosting
Allocated 9 years ago on Nov 13, 2013

IP Address Ranges

Netblock Company Num of IPs
104.140.0.0/22 Eonix Communications 1,024
104.140.104.0/22 ServerHub Dallas DAL1228 1,024
104.140.108.0/22 ServerHub 1,024
104.140.110.0/23 KLAYER LLC 512
104.140.112.0/22 ServerHub Seattle 1,024
104.140.116.0/22 Nate Leaver 1,024
104.140.120.0/22 xiaoyuhost 1,024
104.140.12.0/22 ServerHub Seattle 1,024
104.140.124.0/22 USAccess 1,024
104.140.124.0/23 USAccess 512
104.140.128.0/22 Targeted Email Design 1,024
104.140.132.0/22 SuperVPSspin 1,024
104.140.136.0/22 ServerHub Phoenix 1,024
104.140.140.0/22 AMG Network Hosting, LLC 1,024
104.140.144.0/22 Nate Leaver 1,024
104.140.148.0/22 Maria Silva 1,024
104.140.152.0/22 Nate Leaver 1,024
104.140.156.0/22 Nate Leaver 1,024
104.140.160.0/22 AlsonMedia LLC 1,024
104.140.16.0/22 ServerHub Seattle 1,024
104.140.164.0/22 HelloMails 1,024
104.140.168.0/22 Serghiy Soborniy 1,024
104.140.172.0/22 ServerHub 1,024
104.140.176.0/22 Serghiy Soborniy 1,024
104.140.180.0/22 Dash 1,024
104.140.184.0/22 ServerHub Dallas 1,024
104.140.192.0/22 Nate Leaver 1,024
104.140.196.0/22 Eonix Corporation 1,024
104.140.200.0/22 ServerHub New York 1,024
104.140.20.0/22 ServerHub Seattle 1,024
104.140.204.0/22 Eonix Corporation 1,024
104.140.208.0/22 LinkGrid LLC 1,024
104.140.212.0/22 KBS 1,024
104.140.216.0/24 Virtual Machine Solutions LLC 256
104.140.217.0/24 SuperVPSspin 256
104.140.218.0/23 SuperVPSspin 512
104.140.220.0/22 Trusted Web Services Ltd 1,024
104.140.224.0/22 Clicks Addiction 1,024
104.140.228.0/22 Direct Inbox Delivery 1,024
104.140.232.0/22 GENXLEAD 1,024
104.140.236.0/22 Barderro Host 1,024
104.140.240.0/22 ServerHub New York 1,024
104.140.24.0/22 SenderSwift 1,024
104.140.244.0/22 ServerHub New York 1,024
104.140.248.0/22 Eonix Corporation 1,024
104.140.252.0/23 Eonix Communications 512
104.140.254.0/23 Eonix Communications 512
104.140.28.0/22 galaxiehost.com 1,024
104.140.28.0/23 galaxiehost.com 512
104.140.32.0/22 Eonix Corporation 1,024
104.140.36.0/22 Pinnacle Marketing 1,024
104.140.40.0/22 galaxiehost.com 1,024
104.140.4.0/22 Buyproxies.org 1,024
104.140.44.0/22 Nate Leaver 1,024
104.140.48.0/22 Revmall Media LLC 1,024
104.140.52.0/22 Eonix Corporation 1,024
104.140.56.0/22 White Star 1,024
104.140.60.0/22 SmartHosting 1,024
104.140.64.0/22 Sales Data Pro 1,024
104.140.68.0/22 BDK Media LLC 1,024
104.140.72.0/22 LinkGrid LLC 1,024
104.140.76.0/22 ServerHub Seattle 1,024
104.140.80.0/22 Buyproxies.org 1,024
104.140.8.0/22 ServerHub Seattle 1,024
104.140.84.0/22 GND SEO & DESIGN 1,024
104.140.88.0/22 Green Fish Media Group 1,024
104.140.92.0/22 Eonix Corporation 1,024
104.140.96.0/22 Eonix Corporation 1,024
104.206.0.0/22 ServerHub Seattle 1,024
104.206.100.0/22 Eonix Corporation 1,024
104.206.104.0/22 Maria Silva 1,024
104.206.108.0/22 Eonix Corporation 1,024
104.206.112.0/22 Virtual Machine Solutions LLC 1,024
104.206.116.0/22 ServerHub Dallas 1,024
104.206.120.0/22 Mode Inc 1,024
104.206.12.0/22 ServerHub Toronto 1,024
104.206.124.0/22 ServerHub Seattle 1,024
104.206.128.0/22 GDNP LLC 1,024
104.206.132.0/22 Nate Leaver 1,024
104.206.136.0/22 branchout.com 1,024
104.206.140.0/22 2Empirez-tech 1,024
104.206.144.0/22 Creative Click Networks 1,024
104.206.148.0/22 ServerHub Dallas 1,024
104.206.152.0/22 Red-Proxy 1,024
104.206.156.0/22 Red3Media 1,024
104.206.160.0/22 Eonix Corporation 1,024
104.206.16.0/22 Epidrive Webhosting Solutions 1,024
104.206.164.0/22 Canhui Chen 1,024
104.206.168.0/21 Srvify.com 2,048
104.206.172.0/22 Srvify.com 1,024
104.206.176.0/22 Marian Marius 1,024
104.206.178.0/23 Brick Run Media 512
104.206.180.0/22 Marian Marius 1,024
104.206.184.0/22 Eonix Corporation 1,024
104.206.192.0/22 MASSIVE 1,024
104.206.196.0/22 SuperVPSspin 1,024
104.206.200.0/22 Nan Nan 1,024
104.206.20.0/22 Canhui Chen 1,024
104.206.204.0/22 ServerHub New York 1,024
104.206.208.0/22 XRW Media, LLC. 1,024
Netblock Company
2607:ff28:2::/48 Srvify.com
2607:ff28::/32 Eonix Corporation
2607:ff28::/36 Eonix Corporation
2607:ff28:5000::/36 Eonix Corporation
2607:ff28:5002::/48 Eonix Corporation
2607:ff28:7000::/36 Eonix Corporation
2607:ff28:8000::/36 Eonix Corporation
2607:ff28:9000::/36 Eonix Corporation
2607:ff28:9::/48 Eonix Corporation
2607:ff28:a000::/36 Eonix Corporation
2607:ff28:b000::/36 Eonix Corporation
2607:ff28:b002::/48 Eonix Corporation
2607:ff28:b005::/48 Eonix Corporation
2607:ff28:b007::/48 Eonix Corporation
2607:ff28:b016::/48 Eonix Corporation
2607:ff28:b02a::/48 Eonix Corporation
2607:ff28:c000::/36 Eonix Corporation
2607:ff28:d000::/36 Eonix Corporation
2607:ff28:e000::/36 Eonix Corporation
Get all this data and more in JSON format using our ASN API Read More

WHOIS Details

ASHandle:       AS62904
OrgID:          EONIX
ASName:         AS62904
ASNumber:       62904
RegDate:        2013-11-13
Comment:        AS62904 :: Eonix Global Internet AS Number carries routes for the following North American markets:  
Comment:        - Dallas TX
Comment:        - Chicago IL 
Comment:        - New York, NY
Comment:        - Seattle WA
Comment:        - Los Angeles CA
Comment:        - Phoenix AZ
Comment:        - Miami FL
Comment:        Peering requests for AS62904 are primarily comprised of requests within the North American region. All other requests outside of this region may be submitted to us via peering DB and should correspond to the appropriate region. 
Comment:        Please see technical, Abuse and NOC details for all other inquiries related to this AS
Updated:        2021-11-24
Source:         ARIN


OrgID:          EONIX
OrgName:        Eonix Corporation
CanAllocate:    
Street:         3773 Howard Hughes Pkwy. Suite 500S
City:           Las Vegas
State/Prov:     NV
Country:        US
PostalCode:     89169-6014
Comment:        Please use the below contact information to report suspected security issues specific to traffic emanating from net blocks in this range, including the distribution of malicious content or other illicit or illegal material.
Comment:        For SPAM and other abuse issues, please contact: 
Comment:        * net-abuse@eonix.net 
Comment:        For legal and law enforcement-related requests, please contact: 
Comment:        * legal@eonix.net 
Comment:        For Routing, Peering or DNS issues, please contact:
Comment:        * noc@eonix.net
RegDate:        2006-05-31
Updated:        2022-09-20
OrgAbuseHandle: NTS22-ARIN
OrgAdminHandle: NOC31884-ARIN
OrgDNSHandle:   EDM7-ARIN
OrgNOCHandle:   NOC31884-ARIN
OrgTechHandle:  EDM7-ARIN
OrgTechHandle:  NOC31884-ARIN
Source:         ARIN


POCHandle:      NTS22-ARIN
IsRole:         Y
LastName:       Network Trust and Safety
FirstName:      
Street:         3773 Howard Hughes Parkway 500
City:           Las Vegas
State/Prov:     NV
Country:        US
PostalCode:     89169
RegDate:        2014-05-12
Updated:        2022-09-20
OfficePhone:    +1-702-605-2981
Mailbox:        net-admin@eonix.net
Source:         ARIN


POCHandle:      NOC31884-ARIN
IsRole:         Y
LastName:       Network Operations Center
FirstName:      
Street:         3773 Howard Hughes Parkway 500
City:           Las Vegas
State/Prov:     NV
Country:        US
PostalCode:     89169
RegDate:        2014-05-12
Updated:        2022-09-20
OfficePhone:    +1-702-605-2981
Mailbox:        noc@eonix.net
Source:         ARIN


POCHandle:      EDM7-ARIN
IsRole:         Y
LastName:       Eonix DNS Management 
FirstName:      
Street:         3773 Howard Hughes Parkway 500S
City:           Las Vegas
State/Prov:     NV
Country:        US
PostalCode:     89169
RegDate:        2021-01-20
Updated:        2022-01-22
OfficePhone:    +1-877-841-3341
Mailbox:        902214@serverhub.com
Source:         ARIN
Get all this data and more in JSON format using our ASN API Read More

Hosted Domains

There are 471,328 domain names hosted across 218,638 IP addresses on this ASN.

IP Address Domain Domains on this IP
104.206.57.52 ujitip.com 6,958
170.130.40.34 triusiourvas.info 1,830
104.206.252.90 ahlefind.com 1,560
104.140.112.126 decarburationundiluvialexcommunication.cyou 1,034
170.130.40.160 leathertools.com.ua 862
104.140.185.12 maserabnormalisingloft.cfd 493
170.130.40.107 businessguarantor.com 475
104.140.20.142 reverseparaleipsisnonoppression.site 431
170.130.40.14 happyb.com.ua 387
107.158.163.33 ecepoh.me 347
104.140.79.234 mizubaths.com 322
104.206.225.200 vacavillecofc.org 304
107.158.163.202 ujitac.link 222
173.232.138.66 wirepullingcurarisuperlaryngeal.us 202
104.140.185.10 unembracedlimerickfivefold.rest 195
173.232.138.69 frischacmiteprocrastinativeness.us 192
104.140.185.13 cloturestrakenonrheumatic.monster 181
173.232.138.67 durointerhabitationinitial.us 171
173.232.138.68 dulcifyingvernacularisingdisguisedness.work 158
104.140.185.14 unvattedshrinksirenas.com 132
104.140.185.11 anaimamshiprecessively.com 131
170.130.40.126 burea-uinsurance.com 127
206.214.79.117 steepingdeputy.space 122
104.140.64.42 kimdesk.rest 122
173.232.138.71 alkalinisingspeechlessnessliquefying.us 117
170.130.40.168 darsh.org 115
173.232.138.70 blindsledgejulep.us 115
206.214.79.87 tapingquickness.fit 108
50.2.108.6 remeditor.buzz 100
50.2.198.150 ahfuke120.com 94
50.2.128.243 penchaindared.world 92
104.206.99.158 saltlakecitycriminaldefenselawyer.com 90
170.130.213.195 435luxurycars.com 89
23.231.40.68 ehokaj.com 86
173.44.236.125 unsere-dienstleistungen.online 80
104.206.225.254 djmapp.com 78
104.206.148.82 irfordnadertisystah.cam 76
206.214.79.46 answeredimpacted.pro 75
23.231.24.14 myalogistica.com 70
206.214.79.146 brakemandiebold.rest 66
50.2.6.116 rivergram.com 65
50.2.213.18 hostivator.com 65
173.232.242.182 afterfall.buzz 64
104.140.245.133 riverside.org 62
170.130.40.5 blucollarz.com 60
170.130.111.3 gangaramaya.lk 59
173.232.229.108 sergenmdp.com 56
170.130.2.2 dailyvesta.com 55
104.206.252.126 maleenhancementt.us 54
206.214.79.130 potspiles.online 54

Hosted domains API

Our Hosted Domains API, or Reverse IP API returns a full list of domains that are hosted on a single IP address.
Useful for Cybersecurity

Peers

There are 29 peers for this ASN.

Peers Name
AS11164 Internet2
AS11403 NYI
AS1299 Telia Company AB
AS13030 Init7 (Switzerland) Ltd.
AS137409 GSL Networks Pty LTD
AS13786 Seabras 1 USA, LLC
AS174 Cogent Communications
AS1828 Unitas Global LLC
AS19151 BroadbandONE, LLC
AS19754 The Fusion Network, LLC
AS22356 Durand do Brasil Ltda
AS23033 Wowrack.com
AS24482 SG.GS
AS25091 IP-Max SA
AS263237 PowerHost Telecom SPA
AS271253 LINK BRASIL TELECOMUNICACOES LTDA
AS28186 ITS TELECOMUNICACOES LTDA
AS2914 NTT America, Inc.
AS29791 Internap Holding LLC
AS3303 Swisscom (Schweiz) AG
AS33891 Core-Backbone GmbH
AS35280 F5 Networks SARL
AS36351 SoftLayer Technologies Inc.
AS4826 Vocus Connect International Backbone
AS52320 GlobeNet Cabos Submarinos Colombia, S.A.S.
AS53828 NETWORK INNOVATIONS, LLC
AS61832 Fortel Fortaleza Telecomunicacoes Ltda
AS6939 Hurricane Electric LLC
AS8220 COLT Technology Services Group Limited
Get all this data and more in JSON format using our ASN API Read More

Upstreams

There are 6 upstreams for this ASN.

upstreams Name
AS11403 NYI
AS1299 Telia Company AB
AS174 Cogent Communications
AS23033 Wowrack.com
AS2914 NTT America, Inc.
AS6939 Hurricane Electric LLC
Get all this data and more in JSON format using our ASN API Read More

Downstreams

There is 1 peer for this ASN.

Downstreams Name
AS49532 Eonix Corporation
Get all this data and more in JSON format using our ASN API Read More

Related Networks

What is an ASN?

Autonomous System Numbers (ASNs) are assigned to entities such as Internet Service Providers and other large organizations that control blocks of IP addresses. This network page, and the organization field that's shown on the main IP address information page and also returned in the geolocation API are based on the ASN.

The ASN details will often correspond to the IP address owner, but for smaller organizations it may be that organization's parent, or their ISP. Find out more about AS62904 at robtex.

An API built with users in mind: reliable, accurate, and easy-to-use

Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.

IPinfo for all your IP geolocation needs

Our IP tools

Explore all tools
What is my IP

What is my IP

Test our data accuracy by viewing insights from your IP address.

See your IP address
Map IPs

Map IPs

Paste up to 500,000 IPs to see where they're located on a map.

Try Map IPs
Summarize IPs

Summarize IPs

Use our data visualization tool to create a visual overview of multiple IPs.

Try Summarize IPs