AS52219 - routernetworks.net

Router Networks LLC

AS52219 Router Networks LLC

Country

United States

Allocated

2016-06-21T08:39:35Z

Registry

ripe

IP Addresses

5,376

Type

business

Network Speed

We don't currently have any network speed data for this network.

Hosted Domains

There are 2,106 domain names hosted across 659 IP addresses on this ASN.

Show Domains

Whois Details

aut-num:        AS52219
as-name:        routernetworks
org:            ORG-RNL20-RIPE
sponsoring-org: ORG-DMF2-RIPE
admin-c:        DUMY-RIPE
tech-c:         DUMY-RIPE
status:         ASSIGNED
mnt-by:         RIPE-NCC-END-MNT
mnt-by:         mnt-routernetworks
created:        2016-06-21T08:39:35Z
last-modified:  2018-09-04T11:49:34Z
source:         RIPE
remarks:        ****************************
remarks:        * THIS OBJECT IS MODIFIED
remarks:        * Please note that all data that is generally regarded as personal
remarks:        * data has been removed from this object.
remarks:        * To view the original object, please query the RIPE Database at:
remarks:        * http://www.ripe.net/whois
remarks:        ****************************


organisation:     ORG-RNL20-RIPE
org-name:         Router Networks LLC
org-type:         OTHER
address:          1521 State of Delaware Concord Pike
e-mail:           dave@routernetworks.net
abuse-c:          RNL7-RIPE
mnt-ref:          mnt-routernetworks
mnt-by:           mnt-routernetworks
created:          2016-06-17T20,56,36Z
last-modified:    2016-06-17T20,56,36Z
source:           RIPE



as-block:       AS47104 - AS52223
descr:          RIPE NCC ASN block
remarks:        These AS Numbers are assigned to network operators in the RIPE NCC service region.
mnt-by:         RIPE-NCC-HM-MNT
created:        2015-09-30T14:19:22Z
last-modified:  2015-09-30T14:19:22Z
source:         RIPE

aut-num:        AS52219
as-name:        routernetworks
org:            ORG-RNL20-RIPE
sponsoring-org: ORG-DMF2-RIPE
admin-c:        RNL7-RIPE
tech-c:         RNL7-RIPE
status:         ASSIGNED
mnt-by:         RIPE-NCC-END-MNT
mnt-by:         mnt-routernetworks
mnt-routes:     mnt-routernetworks
created:        2016-06-21T08:39:35Z
last-modified:  2017-11-15T12:38:25Z
source:         RIPE

organisation:   ORG-RNL20-RIPE
org-name:       Router Networks LLC
org-type:       OTHER
address:        1521 State of Delaware Concord Pike
e-mail:         dave@routernetworks.net
abuse-c:        RNL7-RIPE
mnt-ref:        mnt-routernetworks
mnt-by:         mnt-routernetworks
created:        2016-06-17T20:56:36Z
last-modified:  2016-06-17T20:56:36Z
source:         RIPE

role:           Router Networks LLC
address:        1521 State of Delaware Concord Pike
e-mail:         dave@routernetworks.net
nic-hdl:        RNL7-RIPE
abuse-mailbox:  dave@routernetworks.net
mnt-by:         mnt-routernetworks
created:        2016-06-17T20:55:37Z
last-modified:  2016-06-17T20:56:27Z
source:         RIPE

IP Address Ranges

Netblock Description Num IPs
165.231.192.0/24 Fiber Grid INC 256
165.231.196.0/24 Fiber Grid INC 256
165.231.216.0/24 Dallas, TX 75202 256
165.231.49.0/24 Global Routing Networks 256
165.231.50.0/24 Global Routing Networks 256
165.231.51.0/24 Global Routing Networks 256
165.231.52.0/24 Global Routing Networks 256
196.196.232.0/24 West 6th Street, Los Angeles, CA 90014 US 256
196.196.233.0/24 West 6th Street, Los Angeles, CA 90014 US 256
196.245.148.0/24 Bratislava 256

There are no known IPv6 addresses belonging to this network

Network Speed

We don't currently have any network speed data for this network.

Hosted Domains

There are 2,106 domain names hosted across 659 IP addresses on this ASN. Checkout our API to access full domain hosting information.

IP Address Domain Domains on this IP
196.196.233.155 clevelandcyclewerksmalaysia.webr.ly 16
165.231.50.185 osteriagrillo.it 10
165.231.50.182 fitemplatepicsg.com 10
165.231.50.177 mundabla.com 10
165.231.50.134 reallysimplesites.co.uk 10
165.231.50.135 stage4cancerforum.com 9
165.231.50.190 bauernverband-uri.ch 9
165.231.50.174 noicultura.it 9
165.231.50.178 polishedandglittered.com 9
165.231.50.180 suschemalliance.ca 9

Peers

There are no peers for this ASN.

Upstreams

There are no upstreams for this ASN.

Downstreams

There are no downstreams for this ASN.

Get Started

Utilize our APIs to get information on any IP address including geolocation, ASN and hostname. It is forever FREE for up to 1000 requests per day.

No Credit card required

Details

Autonomous System Numbers (ASNs) are assigned to entities such as Internet Service Providers and other large organizations that control blocks of IP addresses. This network page, and the organization field that's shown on the main IP address information page and also returned in the geolocation API are based on the ASN.

The ASN details will often correspond to the IP address owner, but for smaller organizations it may be that organization's parent, or their ISP.

Find out more about AS52219 at robtex.

Try our JSON API from the command line

Get started with curl ipinfo.io or check out the documentation to read more.

Documentation
Free for small projects. Pay as you grow.

Our API is free for up to 1,000 requests per day. Our plans suits the company of every size.

Plans & Pricing
A million uses. Easy to implement.

From filtering out bot traffic, to performing bulk IP geolocation, we’ve got it all covered.

Guides